ARG59272
anti-KDM5B / Jarid1B antibody
Size
£408.00
- SKU:
- ARG59272
- Additional Names:
- lysine (K)-specific demethylase 5B
- Application:
- Flow Cytometry, WB, IHC-P, IF, ICC
- Concentration:
- 0.5
- Molecular Weight:
- 176 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Bovine, Canine, Hamster, Human, Mouse, Rabbit, Rat, Equine
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4 and 4% Trehalose.
- Immunogen:
- Synthetic peptide corresponding to aa. 641-685 of Human KDM5B / Jarid1B. (DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELL)
- Synonyms:
- PPP1R98; Histone demethylase JARID1B; PUT1; RBBP2H1A; Cancer/testis antigen 31; Jumonji/ARID domain-containing protein 1B; Retinoblastoma-binding protein 2 homolog 1; PLU-1; PLU1; RBP2-H1; CT31; EC 1.14.11.-; Lysine-specific demethylase 5B; JARID1B
- Gene Details:
- 10765
- Shipping Conditions:
- Blue Ice