ARG59266
anti-PIAS3 antibody
Size
£429.00
- SKU:
- ARG59266
- Additional Names:
- protein inhibitor of activated STAT, 3
- Application:
- WB, IF, ICC
- Concentration:
- Batch dependent: 0.5 - 1
- Molecular Weight:
- 68 kDa
- Purification:
- Purification with Protein A.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Bovine, Canine, Human, Mouse, Porcine, Rat, Equine, Guinea Pig
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- Immunogen:
- Synthetic peptide around the C-terminal region of Human PIAS3. (within the following region: TSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIV)
- Synonyms:
- Protein inhibitor of activated STAT protein 3; E3 SUMO-protein ligase PIAS3; EC 6.3.2.-; ZMIZ5
- Gene Details:
- 10401
- Shipping Conditions:
- Blue Ice