anti-SMC3 antibody [4C12]

Size

£408.00

SKU:: ARG59233
Additional Names:: structural maintenance of chromosomes 3
Application:: WB, IHC-P
Concentration:: 0.5
Molecular Weight:: 142 kDa
Purification:: Affinity purification with immunogen.
Storage Conditions:: For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Supplier:: Arigo Biolaboratories
Host:: Mouse
Reactivities:: Human, Mouse, Rat
Buffer:: 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose.
Immunogen:: Synthetic peptide corresponding to aa. 1178-1216 of Human SMC3. (ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH)
Clone:: 4C12
Synonyms:: CDLS3; CSPG6; SMC3L1; SMC-3; Chromosome-associated polypeptide; BMH; Basement membrane-associated chondroitin proteoglycan; Structural maintenance of chromosomes protein 3; Bamacan; hCAP; Chondroitin sulfate proteoglycan 6; SMC protein 3; HCAP; BAM
Gene Details:: 9126