ARG59224
anti-PTP4A2 antibody
Size
£408.00
- SKU:
- ARG59224
- Additional Names:
- protein tyrosine phosphatase type IVA, member 2
- Application:
- Flow Cytometry, WB, IHC-P
- Concentration:
- 0.5
- Molecular Weight:
- 19 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Hamster, Human, Mouse, Rat
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 40-69 of Human PTP4A2. (TTLVRVCDATYDKAPVEKEGIHVLDWPFDD)
- Synonyms:
- OV-1; Protein-tyrosine phosphatase of regenerating liver 2; PTP4A; Protein tyrosine phosphatase type IVA 2; PTPCAAX2; PRL2; ptp-IV1b; ptp-IV1a; CAAXII; PRL-2; HH13; Protein-tyrosine phosphatase 4a2; EC 3.1.3.48; HU-PP-1; PTP; HH7-2
- Gene Details:
- 8073
- Shipping Conditions:
- Blue Ice