ARG59204
anti-Regucalcin antibody
Size
£408.00
- SKU:
- ARG59204
- Additional Names:
- regucalcin
- Application:
- IHC-P
- Concentration:
- 0.5
- Molecular Weight:
- 33 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose.
- Immunogen:
- Synthetic peptide corresponding to a sequence of Human Regucalcin. (YSVDAFDYDLQTGQISNRRSVYKLEKEEQIPD)
- Synonyms:
- EC 3.1.1.17; Senescence marker protein 30; Gluconolactonase; Regucalcin; HEL-S-41; SMP-30; SMP30; RC; GNL
- Gene Details:
- 9104
- Shipping Conditions:
- Blue Ice