ARG59133
anti-TAP1 antibody
Size
£408.00
- SKU:
- ARG59133
- Additional Names:
- transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
- Application:
- IHC-P
- Concentration:
- 0.5
- Molecular Weight:
- 87 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Human
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 438-471 of Human TAP1. (RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN)
- Synonyms:
- Really interesting new gene 4 protein; ABC17; TAP1*0102N; ATP-binding cassette sub-family B member 2; TAP1N; RING4; Antigen peptide transporter 1; ABCB2; APT1; Peptide transporter involved in antigen processing 1; PSF-1; D6S114E; PSF1; Peptide transporter PSF1; Peptide transporter TAP1; Peptide supply factor 1
- Gene Details:
- 6890
- Shipping Conditions:
- Blue Ice