ARG59046
anti-MDM4 / MDMX antibody
Size
£408.00
- SKU:
- ARG59046
- Additional Names:
- MDM4, p53 regulator
- Application:
- WB, IHC-P
- Concentration:
- 0.5
- Molecular Weight:
- 55 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Bovine, Human, Mouse, Rabbit, Equine
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 35-72 of Human MDMX (KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH).
- Synonyms:
- Double minute 4 protein; p53-binding protein Mdm4; MDMX; Protein Mdm4; Mdm2-like p53-binding protein; HDMX; MRP1; Protein Mdmx
- Gene Details:
- 4194
- Shipping Conditions:
- Blue Ice