ARG59042
anti-RBBP4 / RbAp48 antibody
Size
£408.00
- SKU:
- ARG59042
- Additional Names:
- retinoblastoma binding protein 4
- Application:
- Flow Cytometry, WB, IHC-P, IHC-Fr, IF, ICC
- Concentration:
- 0.5
- Molecular Weight:
- 48 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Hamster, Human, Mouse, Rat
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 395-425 of Human RbAp48 (EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS).
- Synonyms:
- Retinoblastoma-binding protein 4; Retinoblastoma-binding protein p48; Chromatin assembly factor I p48 subunit; Nucleosome-remodeling factor subunit RBAP48; RBBP-4; NURF55; lin-53; CAF-I p48; CAF-I 48 kDa subunit; Chromatin assembly factor 1 subunit C; CAF-1 subunit C; RBAP48; Histone-binding protein RBBP4
- Gene Details:
- 5928
- Shipping Conditions:
- Blue Ice