ARG59034
anti-Peroxiredoxin 4 antibody
Size
£408.00
- SKU:
- ARG59034
- Additional Names:
- peroxiredoxin 4
- Application:
- Flow Cytometry, WB, IHC-P, IF, ICC
- Concentration:
- 0.5
- Molecular Weight:
- 31 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 178-208 of Human Peroxiredoxin 4 (SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK).
- Synonyms:
- EC 1.11.1.15; AOE372; Antioxidant enzyme AOE372; HEL-S-97n; Thioredoxin-dependent peroxide reductase A0372; Peroxiredoxin IV; Peroxiredoxin-4; PRX-4; Prx-IV; Thioredoxin peroxidase AO372; AOE37-2
- Gene Details:
- 10549
- Shipping Conditions:
- Blue Ice