ARG59017
anti-NFIB / NF1B2 antibody
Size
£408.00
- SKU:
- ARG59017
- Additional Names:
- nuclear factor I/B
- Application:
- WB, IHC-P
- Concentration:
- 0.5
- Molecular Weight:
- 47 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose.
- Immunogen:
- Synthetic peptide corresponding to a sequence of Human NFIB / NF1B2 (ELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR).
- Synonyms:
- NFI-RED; Nuclear factor 1/B; HMGIC/NFIB; TGGCA-binding protein; Nuclear factor 1 B-type; NF-I/B; NF1-B; CTF; CCAAT-box-binding transcription factor; NFI-B; NFIB2; NFIB3; Nuclear factor I/B
- Gene Details:
- 4781
- Shipping Conditions:
- Blue Ice