ARG58938
anti-UTS2R / GPR14 antibody
Size
£429.00
- SKU:
- ARG58938
- Additional Names:
- urotensin 2 receptor
- Application:
- WB
- Concentration:
- Batch dependent: 0.5 - 1
- Molecular Weight:
- 42 kDa
- Purification:
- Affinity purified.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Human
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- Immunogen:
- Synthetic peptide from Human UTS2R / GPR14. (within the following region: WGPRAHRAYLTLLFATSIAGPGLLIGLLYARLARAYRRSQRASFKRARRP)
- Synonyms:
- Urotensin-2 receptor; GPR14; Urotensin II receptor; UR-2-R; UTR; UR-II-R; G-protein coupled receptor 14; UTR2
- Gene Details:
- 2837
- Shipping Conditions:
- Blue Ice