ARG58839
anti-CD127 / IL7R antibody
Size
£408.00
- SKU:
- ARG58839
- Additional Names:
- interleukin 7 receptor
- Application:
- Flow Cytometry, WB
- Concentration:
- 0.5
- Molecular Weight:
- 52 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 278-315 of Human CD127 (DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ).
- Synonyms:
- ILRA; CD127; IL-7R subunit alpha; IL-7R-alpha; IL7RA; CD antigen CD127; Interleukin-7 receptor subunit alpha; CDW127; CDw127; IL-7 receptor subunit alpha; IL-7RA
- Gene Details:
- 3575
- Shipping Conditions:
- Blue Ice