ARG58711
anti-FMO3 antibody
Size
£408.00
- SKU:
- ARG58711
- Additional Names:
- flavin containing monooxygenase 3
- Application:
- WB
- Concentration:
- 0.5
- Molecular Weight:
- 60 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 404-433 of Human FMO3 (DMMNDINEKMEKKRKWFGKSETIQTDYIVY).
- Synonyms:
- Hepatic flavin-containing monooxygenase 3; FMO form 2; FMOII; TMAU; FMO II; dJ127D3.1; Dimethylaniline oxidase 3; FMO 3; EC 1.14.13.148; Trimethylamine monooxygenase; EC 1.14.13.8; Dimethylaniline monooxygenase [N-oxide-forming] 3
- Gene Details:
- 2328
- Shipping Conditions:
- Blue Ice