ARG58685
anti-CHRNA3 antibody
Size
£408.00
- SKU:
- ARG58685
- Additional Names:
- cholinergic receptor, nicotinic, alpha 3 (neuronal)
- Application:
- Flow Cytometry, WB
- Concentration:
- 0.5
- Molecular Weight:
- 57 kDa
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose.
- Immunogen:
- Synthetic peptide corresponding to a sequence of Human CHRNA3 (DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD).
- Synonyms:
- LNCR2; NACHRA3; Neuronal acetylcholine receptor subunit alpha-3; PAOD2
- Gene Details:
- 1136
- Shipping Conditions:
- Blue Ice