ARG58616
anti-FECH antibody
Size
£429.00
- SKU:
- ARG58616
- Additional Names:
- ferrochelatase
- Application:
- WB, IF, ICC
- Concentration:
- Batch dependent: 0.5 - 1
- Molecular Weight:
- 48 kDa
- Purification:
- Purification with Protein A.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Bovine, Canine, Fish, Human, Mouse, Rabbit, Rat, Yeast, Equine, Guinea Pig
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- Immunogen:
- Synthetic peptide around the N-terminal region of Human FECH. (within the following sequence: LDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGM)
- Synonyms:
- EPP; EC 4.99.1.1; Ferrochelatase, mitochondrial; FCE; Protoheme ferro-lyase; Heme synthase
- Gene Details:
- 2235
- Shipping Conditions:
- Blue Ice