ARG58612
anti-eRF1 antibody
Size
£429.00
- SKU:
- ARG58612
- Additional Names:
- eukaryotic translation termination factor 1
- Application:
- WB, IHC-P
- Concentration:
- Batch dependent: 0.5 - 1
- Molecular Weight:
- 49 kDa
- Purification:
- Affinity purified.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Bovine, Canine, Fish, Human, Mouse, Rabbit, Rat, Yeast, Equine, Guinea Pig
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- Immunogen:
- Synthetic peptide around the N-terminal region of Human eRF1. (within the following sequence: ISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKL)
- Synonyms:
- Protein Cl1; RF1; eRF1; ERF1; Eukaryotic release factor 1; Eukaryotic peptide chain release factor subunit 1; ERF; TB3-1; SUP45L1; D5S1995
- Gene Details:
- 2107
- Shipping Conditions:
- Blue Ice