ARG58594
anti-ERV3 antibody
Size
£408.00
- SKU:
- ARG58594
- Additional Names:
- endogenous retrovirus group 3, member 1
- Application:
- WB
- Concentration:
- 0.5
- Molecular Weight:
- 68 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Human
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 575-604 of Human ERV3. (LELDDEGKVIKEITAKIQKLAHIPVQTWKG).
- Synonyms:
- ERV3 envelope protein; Endogenous retrovirus group 3 member 1 Env polyprotein; HERV-R envelope protein; HERV-R; envR; ERV3-1 envelope protein; SU; ERV-R envelope protein; HERV-R_7q21.2 provirus ancestral Env polyprotein; ERV3; ERVR; Envelope polyprotein; ERV-3 envelope protein; HERVR; ERV-R; TM
- Gene Details:
- 2086
- Shipping Conditions:
- Blue Ice