ARG58575
anti-FABP5 antibody
Size
£408.00
- SKU:
- ARG58575
- Additional Names:
- fatty acid binding protein 5 (psoriasis-associated)
- Application:
- WB, IHC-P
- Concentration:
- 0.5
- Molecular Weight:
- 15 kDa
- Purification:
- Purified.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose.
- Immunogen:
- Synthetic peptide corresponding to a sequence of Mouse FABP5. (KWRLMESHGFEEYMKELGVGLALRKMAAMAKPD).
- Synonyms:
- PA-FABP; Epidermal-type fatty acid-binding protein; KFABP; EFABP; E-FABP; Psoriasis-associated fatty acid-binding protein homolog; Fatty acid-binding protein, epidermal; Fatty acid-binding protein 5; PAFABP
- Gene Details:
- 16592
- Shipping Conditions:
- Blue Ice