anti-CTRB1 antibody

Size

£429.00

SKU:: ARG58550
Additional Names:: chymotrypsinogen B1
Application:: WB
Concentration:: Batch dependent: 0.5 - 1
Molecular Weight:: 28 kDa
Purification:: Affinity purified.
Storage Conditions:: For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Supplier:: Arigo Biolaboratories
Host:: Rabbit
Reactivities:: Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Equine, Guinea Pig
Buffer:: PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Immunogen:: Synthetic peptide around the middle region of Human CTRB1. (within the following sequence: FKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCAT)
Synonyms:: CTRB
Gene Details:: 1504