ARG58435
anti-CRY1 antibody
Size
£408.00
- SKU:
- ARG58435
- Additional Names:
- cryptochrome circadian clock 1
- Application:
- WB, IHC-P
- Concentration:
- 0.5
- Molecular Weight:
- 66 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Bovine, Human, Mouse, Rat
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to a sequence at the N-terminus of Human Cryptochrome I (153-189aa FQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEK), different from the related Mouse sequence by seven amino acids, and from the related Rat sequence by six amino aci
- Synonyms:
- Cryptochrome-1; PHLL1
- Gene Details:
- 1407
- Shipping Conditions:
- Blue Ice