ARG58372
anti-ATP2A3 / SERCA3 ATPase antibody
Size
£429.00
- SKU:
- ARG58372
- Additional Names:
- ATPase, Ca++ transporting, ubiquitous
- Application:
- WB
- Concentration:
- Batch dependent: 0.5 - 1
- Molecular Weight:
- 114 kDa
- Purification:
- Affinity purified.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Bovine, Canine, Human, Rabbit, Rat, Equine, Guinea Pig
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- Immunogen:
- Synthetic peptide around the middle region of Human ATP2A3 / SERCA3 ATPase. (within the following sequence: LISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCS)
- Synonyms:
- SERCA3; SR Ca; Sarcoplasmic/endoplasmic reticulum calcium ATPase 3; EC 3.6.3.8; Calcium pump 3; 2+
- Gene Details:
- 489
- Shipping Conditions:
- Blue Ice