ARG58309
anti-Bmi 1 antibody
Size
£408.00
- SKU:
- ARG58309
- Additional Names:
- BMI1 proto-oncogene, polycomb ring finger
- Application:
- WB
- Concentration:
- 0.5
- Molecular Weight:
- 37 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Bovine, Human, Mouse, Rat
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to a sequence in the middle region of Human Bmi1(135-165aa IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR), different from the related Mouse sequence by four amino acids.
- Synonyms:
- PCGF4; RNF51; FLVI2/BMI1; flvi-2/bmi-1
- Gene Details:
- 648
- Shipping Conditions:
- Blue Ice