ARG58139
anti-PML Protein antibody
Size
£413.00
- SKU:
- ARG58139
- Additional Names:
- promyelocytic leukemia
- Application:
- WB, IHC-P
- Concentration:
- 0.5
- Molecular Weight:
- 98 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Mouse
- Buffer:
- PBS, 0.025% Sodium azide and 2.5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 140-177 of Mouse PML Protein. (LADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDN)
- Synonyms:
- RING finger protein 71; RNF71; Promyelocytic leukemia protein; TRIM19; Protein PML; PP8675; MYL; Tripartite motif-containing protein 19
- Gene Details:
- 18854
- Shipping Conditions:
- Blue Ice