ARG58134
anti-Stathmin 1 antibody
Size
£413.00
- SKU:
- ARG58134
- Additional Names:
- stathmin 1
- Application:
- Flow Cytometry, WB, IHC-P, IF, ICC
- Concentration:
- 0.5
- Molecular Weight:
- 17 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Buffer:
- PBS, 0.025% Sodium azide and 2.5% BSA.
- Immunogen:
- Synthetic peptide of Human Stathmin 1. (ASSDIQVKELEKRASGQAFELILSPRSKESVPE)
- Synonyms:
- PP17; Prosolin; Stathmin; Protein Pr22; PR22; Lag; C1orf215; PP19; pp19; SMN; OP18; Leukemia-associated phosphoprotein p18; LAP18; pp17; Oncoprotein 18; Phosphoprotein p19; Op18; Metablastin
- Gene Details:
- 3925
- Shipping Conditions:
- Blue Ice