ARG43058
anti-MORC3 antibody
Size
£408.00
- SKU:
- ARG43058
- Additional Names:
- MORC family CW-type zinc finger 3
- Application:
- Flow Cytometry, WB, IF, ICC
- Concentration:
- 0.5
- Molecular Weight:
- 107 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose.
- Immunogen:
- Synthetic peptide corresponding to a sequence of Human MORC3. (ESLKLRSLRVNVGQLLAMIVPDLDLQQVNYDVD)
- Synonyms:
- ZCW5; Zinc finger CW-type coiled-coil domain protein 3; ZCWCC3; NXP2; MORC family CW-type zinc finger protein 3
- Gene Details:
- 23515
- Shipping Conditions:
- Blue Ice