ARG42694
anti-RhoB antibody
Size
£408.00
- SKU:
- ARG42694
- Additional Names:
- ras homolog family member B
- Application:
- WB, IHC-P
- Concentration:
- 0.5
- Molecular Weight:
- 22 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Human
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose.
- Immunogen:
- Synthetic peptide corresponding to a sequence of Human RhoB. (NKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLE)
- Synonyms:
- Rho cDNA clone 6; ARH6; MSTP081; ARHB; h6; Rho-related GTP-binding protein RhoB; MST081; RHOH6
- Gene Details:
- 388
- Shipping Conditions:
- Blue Ice