ARG42649
anti-TPP1 antibody
Size
£408.00
- SKU:
- ARG42649
- Additional Names:
- tripeptidyl peptidase I
- Application:
- WB, IHC-P
- Concentration:
- 0.5
- Molecular Weight:
- 61 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Human
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 227-261 of Human TPP1. (CAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVV)
- Synonyms:
- EC 3.4.14.9; TPP-1; Tripeptidyl-peptidase I; GIG1; Lysosomal pepstatin-insensitive protease; SCAR7; Tripeptidyl aminopeptidase; Tripeptidyl-peptidase 1; CLN2; LPIC; Cell growth-inhibiting gene 1 protein; TPP-I
- Gene Details:
- 1200
- Shipping Conditions:
- Blue Ice