ARG42590
anti-CHM / REP1 antibody
Size
£408.00
- SKU:
- ARG42590
- Additional Names:
- choroideremia (Rab escort protein 1)
- Application:
- Flow Cytometry, WB, IHC-P, IF, ICC
- Concentration:
- 0.5
- Molecular Weight:
- 73 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose.
- Immunogen:
- Synthetic peptide corresponding to a sequence of Human CHM / REP1. (QDQILENEEAIALSRKDKTIQHVEVFCYASQDLHED)
- Synonyms:
- Rab proteins geranylgeranyltransferase component A 1; GGTA; TCD protein; HSD-32; DXS540; REP-1; TCD; Rab escort protein 1; Choroideremia protein
- Gene Details:
- 1121
- Shipping Conditions:
- Blue Ice