anti-IDH1 antibody [16H7]

Size

£408.00

SKU:: ARG42111
Additional Names:: isocitrate dehydrogenase 1 (NADP+), soluble
Application:: Flow Cytometry, WB, IF, ICC
Concentration:: 0.5
Molecular Weight:: 47 kDa
Purity:: > 95% (by SDS-PAGE)
Purification:: Affinity purification with immunogen.
Storage Conditions:: For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Supplier:: Arigo Biolaboratories
Host:: Mouse
Reactivities:: Human, Mouse, Rat
Buffer:: 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose.
Immunogen:: Synthetic peptide corresponding to aa. 381-413 of Human IDH1. (KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK)
Clone:: 16H7
Synonyms:: IDPC; EC 1.1.1.42; Cytosolic NADP-isocitrate dehydrogenase; IDP; HEL-S-26; HEL-216; Isocitrate dehydrogenase [NADP] cytoplasmic; IDH; PICD; IDCD; NADP; Oxalosuccinate decarboxylase
Gene Details:: 3417