ARG41407
anti-NOXO1 antibody
Size
£429.00
- SKU:
- ARG41407
- Additional Names:
- NADPH oxidase organizer 1
- Application:
- WB
- Concentration:
- Batch dependent: 0.5 - 1
- Molecular Weight:
- 41 kDa
- Purification:
- Affinity purified.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Bovine, Human, Equine
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- Immunogen:
- Synthetic peptide derived from Human NOXO1. (within the following region: HSLEAQSLRCLQPFCTQDTRDRPFQAQAQESLDVLLRHPSGWWLVENEDR)
- Synonyms:
- NADPH oxidase regulatory protein; Nox organizer 1; SH3PXD5; P41NOX; Nox-organizing protein 1; SNX28; NADPH oxidase organizer 1; P41NOXC; P41NOXB; P41NOXA; SH3 and PX domain-containing protein 5
- Gene Details:
- 124056
- Shipping Conditions:
- Blue Ice