ARG41395
anti-FGF9 antibody
Size
£408.00
- SKU:
- ARG41395
- Additional Names:
- fibroblast growth factor 9
- Application:
- WB
- Concentration:
- 0.5
- Molecular Weight:
- 23 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose.
- Immunogen:
- Synthetic peptide corresponding to a sequence of Human FGF9 (DHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLY).
- Synonyms:
- Fibroblast growth factor 9; Glia-activating factor; FGF-9; HBFG-9; HBGF-9; GAF; Heparin-binding growth factor 9; SYNS3
- Gene Details:
- 2254
- Shipping Conditions:
- Blue Ice