ARG41272
anti-DHRS9 antibody
Size
£429.00
- SKU:
- ARG41272
- Additional Names:
- dehydrogenase/reductase (SDR family) member 9
- Application:
- WB, IP
- Concentration:
- Batch dependent: 0.5 - 1
- Molecular Weight:
- 35 kDa
- Purification:
- Affinity purified.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Bovine, Canine, Human, Mouse, Rabbit, Rat, Equine, Guinea Pig
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- Immunogen:
- Synthetic peptide around the middle region of Human DHRS9. (within the following region: DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPV)
- Synonyms:
- Tracheobronchial epithelial cell-specific retinol dehydrogenase; 3-alpha-HSD; Short-chain dehydrogenase/reductase retSDR8; RDH-TBE; NADP-dependent retinol dehydrogenase/reductase; 3-alpha hydroxysteroid dehydrogenase; Dehydrogenase/reductase SDR family member 9; RDH15; RDHL; RDH-E2; RETSDR8; Short chain dehydrogenase/reductase family 9C member 4; Retinol dehydrogenase 15; RDHTBE; EC 1.1.-.-; SDR9C4; 3ALPHA-HSD
- Gene Details:
- 10170
- Shipping Conditions:
- Blue Ice