ARG41102
anti-IL28RA antibody
Size
£429.00
- SKU:
- ARG41102
- Additional Names:
- interferon, lambda receptor 1
- Application:
- WB
- Concentration:
- Batch dependent: 0.5 - 1
- Molecular Weight:
- 58 kDa
- Purification:
- Affinity purified.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Bovine, Canine, Human, Mouse, Rabbit, Rat, Equine, Guinea Pig
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- Immunogen:
- Synthetic peptide around the N-terminal region of Human IL28RA. (within the following region: EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF)
- Synonyms:
- IFNLR; IFN-lambda-R1; IL-28RA; IL28RA; Interferon lambda receptor 1; LICR2; CRF2-12; IFN-lambda receptor 1; Cytokine receptor class-II member 12; Interleukin-28 receptor subunit alpha; Likely interleukin or cytokine receptor 2; IL-28R1; CRF2/12; Cytokine receptor family 2 member 12; IL-28R-alpha; IL-28 receptor subunit alpha
- Gene Details:
- 163702
- Shipping Conditions:
- Blue Ice