ARG41101
anti-PDGF BB antibody
Size
£429.00
- SKU:
- ARG41101
- Additional Names:
- platelet-derived growth factor beta polypeptide
- Application:
- WB, IHC-P
- Concentration:
- Batch dependent: 0.5 - 1
- Molecular Weight:
- 27 kDa
- Purification:
- Affinity purified.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Bovine, Canine, Human, Mouse, Rat, Guinea Pig, Ovine
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- Immunogen:
- Synthetic peptide around the N-terminal region (a.a. 2-51) of Human PDGF B. (within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD)
- Synonyms:
- SIS; Becaplermin; Platelet-derived growth factor subunit B; IBGC5; PDGF subunit B; c-sis; SSV; PDGF-2; Proto-oncogene c-Sis; Platelet-derived growth factor beta polypeptide; PDGF2; Platelet-derived growth factor B chain
- Gene Details:
- 5155
- Shipping Conditions:
- Blue Ice