ARG40993
anti-Hsp 70 antibody
Size
£408.00
- SKU:
- ARG40993
- Additional Names:
- heat shock 70kDa protein 1A
- Application:
- Flow Cytometry, WB, IHC-P, IF, ICC
- Concentration:
- 0.5
- Molecular Weight:
- 70 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Bovine, Human, Mouse, Rat, Equine
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 559-596 of Human Hsp 70 (KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR).
- Synonyms:
- Heat shock 70 kDa protein 1A; HSPA1; HSP70I; Heat shock 70 kDa protein 1; HSP70-1A; HEL-S-103; HSP70.1; HSP72; HSP70-1
- Gene Details:
- 3303
- Shipping Conditions:
- Blue Ice