ARG40778
anti-TRPM2 antibody
Size
£429.00
- SKU:
- ARG40778
- Additional Names:
- transient receptor potential cation channel, subfamily M, member 2
- Application:
- WB, IHC-P
- Concentration:
- Batch dependent: 0.5 - 1
- Molecular Weight:
- 171 kDa
- Purification:
- Affinity purified.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Bovine, Canine, Human, Mouse, Rat, Equine, Guinea Pig
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- Immunogen:
- Synthetic peptide around the N-terminal region of Human TRPM2. (Within the following region: VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK)
- Synonyms:
- KNP3; Transient receptor potential cation channel subfamily M member 2; NUDT9H; EREG1; LTrpC2; TrpC7; EC 3.6.1.13; TRPC7; NUDT9L1; LTRPC2; LTrpC-2; Transient receptor potential channel 7; Long transient receptor potential channel 2; Estrogen-responsive element-associated gene 1 protein
- Gene Details:
- 7226
- Shipping Conditions:
- Blue Ice