ARG40708
anti-PDK4 antibody
Size
£408.00
- SKU:
- ARG40708
- Additional Names:
- pyruvate dehydrogenase kinase, isozyme 4
- Application:
- WB
- Concentration:
- 0.5
- Molecular Weight:
- 46 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 91-125 of Human PDK4. (WYIQSLMDLVEFHEKSPDDQKALSDFVDTLIKVRN)
- Synonyms:
- [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial; EC 2.7.11.2; Pyruvate dehydrogenase kinase isoform 4
- Gene Details:
- 5166
- Shipping Conditions:
- Blue Ice
