ARG40705
anti-CD36 antibody
Size
£408.00
- SKU:
- ARG40705
- Additional Names:
- CD36 molecule (thrombospondin receptor)
- Application:
- WB, IHC-P
- Concentration:
- 0.5
- Molecular Weight:
- 53 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 31-66 of Human CD36. (DLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFW)
- Synonyms:
- GPIV; CHDS7; Platelet glycoprotein 4; CD antigen CD36; PAS-4; PASIV; Glycoprotein IIIb; PAS IV; GPIIIB; FAT; SCARB3; GP3B; Leukocyte differentiation antigen CD36; Platelet collagen receptor; BDPLT10; Thrombospondin receptor; GP4; Fatty acid translocase; Platelet glycoprotein IV
- Gene Details:
- 948
- Shipping Conditions:
- Blue Ice