ARG40517
anti-OAS1 antibody
Size
£429.00
- SKU:
- ARG40517
- Additional Names:
- 2'-5'-oligoadenylate synthetase 1, 40/46kDa
- Application:
- WB, IHC-P
- Concentration:
- Batch dependent: 0.5 - 1
- Molecular Weight:
- 46 kDa
- Purification:
- Affinity purified.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Equine
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- Immunogen:
- Synthetic peptide around the N-terminal region of Human OAS1. (within the following region: MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSS)
- Synonyms:
- A; OIASI; p46/p42 OAS; E18/E16; 2-5'; OIAS; IFI-4; EC 2.7.7.84; 2-5A synthase 1; 2'-5'-oligoadenylate synthase 1
- Gene Details:
- 4938
- Shipping Conditions:
- Blue Ice