anti-alpha Actinin 3 antibody [9B5]

Size

£408.00

SKU:: ARG40285
Additional Names:: actinin, alpha 3 (gene/pseudogene)
Application:: WB, IHC-P
Concentration:: 0.5
Molecular Weight:: 103 kDa
Purification:: Affinity purification with immunogen.
Storage Conditions:: For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Supplier:: Arigo Biolaboratories
Host:: Mouse
Reactivities:: Human, Mouse, Rat
Buffer:: 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose.
Immunogen:: Synthetic peptide corresponding to aa. 574-617 of Human alpha Actinin 3. (EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK)
Clone:: 9B5
Synonyms:: Alpha-actinin skeletal muscle isoform 3; F-actin cross-linking protein; Alpha-actinin-3
Gene Details:: 89