ARG40280
anti-NQO1 antibody
Size
£408.00
- SKU:
- ARG40280
- Additional Names:
- NAD(P)H dehydrogenase, quinone 1
- Application:
- WB
- Concentration:
- 0.5
- Molecular Weight:
- 31 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 242-274 of Human NQO1. (EVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK)
- Synonyms:
- DTD; QR1; DHQU; DIA4; NMOR1; NMORI; NAD(P)H dehydrogenase [quinone] 1; EC 1.6.5.2; Azoreductase; DT-diaphorase; DTD; Menadione reductase; NAD(P)H:quinone oxidoreductase 1; Phylloquinone reductase; Quinone reductase 1; QR1
- Gene Details:
- 1728
- Shipping Conditions:
- Blue Ice