ARG10675
anti-IGFBP3 antibody
Size
£413.00
- SKU:
- ARG10675
- Additional Names:
- Insulin Like Growth Factor Binding Protein 3
- Application:
- WB, IHC-P
- Concentration:
- 0.5
- Molecular Weight:
- 32 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Buffer:
- 1X PBS, 0.025% Sodium azide and 2.7% BSA
- Immunogen:
- Synthetic peptide corresponding to the sequence at a.a 214-252 (RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR) around the C-terminus of human IGFBP3 protein.
- Synonyms:
- IBP3; BP-53; IGF-binding protein 3; IGFBP-3
- Gene Details:
- 3486
- Shipping Conditions:
- Blue Ice