75-393-CF
Anti-Kir6.2 Potassium Channel Antibody (BSA and Azide free)
Size
£652.00
- SKU:
- 75-393-CF
- Additional Names:
- ATP-sensitive inward rectifier potassium channel 11 (BIR) (Inward rectifier K(+) channel Kir6.2) (Potassium channel, inwardly rectifying subfamily J member 11)
- Application:
- ELISA, IHC, WB, ICC
- Concentration:
- 1 mg/ml
- Physical State:
- Liquid
- Molecular Weight:
- 45 kDa
- Species Reactivity:
- Rat
- Purification:
- Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and buffer exchanged into 1X PBS. Purified mAbs are >90% specific antibody.|Purified by Protein A chromatography
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles., 2-8[o]C
- Supplier:
- Antibodies Incorporated
- Host:
- Mouse
- Reactivities:
- Mouse, Rat
- Buffer:
- PBS
- Immunogen:
- Fusion protein amino acids 345-390 (TARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISPDSLS, cytoplasmic C-terminus) of rat Kir6.2 (accession number P70673) produced recombinantly in E. Coli
- Formulation:
- PBS
- Clone:
- N363/71
- Uniprot:
- P70673
- Synonyms:
- ATP-sensitive inward rectifier potassium channel 11;BIR;inward rectifier K(+) channel Kir6.2;Kir6.2;potassium channel, inwardly rectifying subfamily J member 11;potassium voltage-gated channel subfamily J member 11
- Extra Details:
- Our carrier-free Anti-Kir6.2 potassium channel mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N363/71. It detects mouse and rat Kir6.2 potassium channel, and is purified by Protein A chromatography. It is great for use in IHC, ICC., AntibodiesInc
- Shipping Conditions:
- Blue Ice