75-366
Anti-MFF Antibody
Size
£468.00
- SKU:
- 75-366
- Additional Names:
- Mitochondrial fission factor
- Application:
- ELISA, IHC, WB, ICC
- Concentration:
- 1 mg/ml
- Physical State:
- Liquid
- Molecular Weight:
- 40 kDa
- Species Reactivity:
- Human
- Purification:
- Protein A Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles., 2-8[o]C
- Supplier:
- Antibodies Incorporated
- Host:
- Mouse
- Reactivities:
- Human, Mouse, Rat
- Buffer:
- 10 mM Tris, 50 mM Sodium Chloride
- Immunogen:
- Fusion protein amino acids 1-173 (MSKRTSSDTPLGRVSGAAFPSPTASEMAEISRIQYEMEYTEGIS QRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQS TPFKPLALKTPPRVLTLSERPLDFLDLERPPVTPQNEEIRAVGRLKRERSMSENAVRQNGQL VRNDSV, cytoplasmic N-terminal exons 1, 2, 3 and 4) and 272-322 (YGISNIEATIEGTSDDM TVVDAASLRRQIIKLNRRLQLLEEENKERAKREM, cytoplasmic N-terminal exons 8 and most of 9) of mostly human MFF (also known as Mitochondrial fission factor, C2orf33, AD030, AD033 and GL004, accession number Q9GZY8); Human: 96% identity (167/173 amino acids identical) and 94% identity (48/51 amino acids identical); Rat: 95% identity (141/147 amino acids identical) and 92% identity (47/51 amino acids identical); Mouse: 93% identity (138/147 amino acids identical) and 84% identity (43/51 amino acids identical)
- Formulation:
- 10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.125
- Clone:
- N382/14
- Uniprot:
- Q9GZY8
- Synonyms:
- C2orf33;EMPF2;GL004;mitochondrial fission factor
- Extra Details:
- Our Anti-MFF mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N382/14. It is KO validated, detects human, mouse, and rat MFF, and is purified by Protein A chromatography. It is great for use in IHC, ICC, WB., AntibodiesInc
- Shipping Conditions:
- Blue Ice