75-314
Anti-Kv1.2 Potassium Channel Subunit Antibody
Size
£468.00
- SKU:
- 75-314
- Additional Names:
- Potassium voltage-gated channel subfamily A member 2 (NGK1) (Voltage-gated K(+) channel HuKIV) (Voltage-gated potassium channel HBK5) (Voltage-gated potassium channel subunit Kv1.2)
- Application:
- ELISA, IHC, WB, ICC
- Concentration:
- 1 mg/ml
- Physical State:
- Liquid
- Molecular Weight:
- 80 kDa
- Species Reactivity:
- Human
- Purification:
- Protein A Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles., 2-8[o]C
- Supplier:
- Antibodies Incorporated
- Host:
- Mouse
- Reactivities:
- Human, Mouse, Rat
- Buffer:
- 10 mM Tris, 50 mM Sodium Chloride
- Immunogen:
- Fusion protein amino acids 428-499 (QYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSN EDFREENLKTANCTLANTNYVNITKMLTDV, cytoplasmic C-terminus) of human Kv1.2 (accession number P16389) produced recombinantly in E. Coli
- Formulation:
- 10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.125
- Clone:
- L76/36
- Uniprot:
- P16389
- Synonyms:
- DEE32;EIEE32;HBK5;HK4;HUKIV;KV1.2;MK2;NGK1;potassium channel, voltage gated shaker related subfamily A, member 2;potassium voltage-gated channel subfamily A member 2;potassium voltage-gated channel, shaker-related subfamily, member 2;RBK2;voltage-gated K(+) channel HuKIV;voltage-gated potassium channel HBK5;voltage-gated potassium channel protein Kv1.2;voltage-gated potassium channel subunit Kv1.2
- Extra Details:
- Our Anti-Kv1.2 potassium channel subunit mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone L76/36. It is KO validated, detects human, mouse, and rat Kv1.2 potassium channel subunit, and is purified by Protein A chromatography. It is great for use in IHC, WB., AntibodiesInc
- Shipping Conditions:
- Blue Ice