75-002
Anti-GluA2/GluR2 Glutamate Receptor Antibody
Size
£538.00
- SKU:
- 75-002
- Additional Names:
- Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)
- Application:
- ELISA, IHC, WB, ICC, IP, EM
- Concentration:
- 1 mg/ml
- Physical State:
- Liquid
- Molecular Weight:
- 90 kDa
- Species Reactivity:
- Rat
- Purification:
- Protein A Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles., 2-8[o]C
- Supplier:
- Antibodies Incorporated
- Host:
- Mouse
- Reactivities:
- Human, Mouse, Rat
- Buffer:
- 10 mM Tris, 50 mM Sodium Chloride
- Immunogen:
- Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli
- Formulation:
- 10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.4
- Clone:
- L21/32
- Uniprot:
- P19491
- Synonyms:
- AMPA-selective glutamate receptor 2;GluA2;gluR-B;GluR-K2;GluR2;glutamate receptor 2;glutamate receptor B;Glutamate receptor ionotropic, AMPA 2;glutamate receptor, ionotropic, AMPA 2
- Extra Details:
- Our Anti-GluA2/GluR2 glutamate receptor mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone L21/32. It is KO validated, detects human, mouse, and rat GluA2/GluR2 glutamate receptor, and is purified by Protein A chromatography. It is great for use in EM, IHC, ICC, IP, WB., AntibodiesInc
- Shipping Conditions:
- Blue Ice