RPT0037
Recombinant Cynomolgus IgE Protein
Size
£181.00
- SKU:
- RPT0037
- Additional Names:
- Ig-like domain-containing protein ,EGM_20642,IgE
- Molecular Weight:
- 35-40 kDa
- Purity:
- ≥90%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Lys208-Lys429
- Formulation:
- Recombinant Cynomolgus IgE Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys208-Lys429) of Cynomolgus IgE (Accession # G8F4W7) fused with His tag and Avi tag at the C-terminus.
- Species:
- Non-human Primate
- Sequence:
- KCADSNPRGVSAYLSRPSPFDLFISKSPTITCLVVDLAPSKETVNLTWSRASGKPVPHIPATEKKQQRNGTLTVTSILPVVTQDWIEGETYQCRVIHPHLPRALVRSMTKTSGPRAAPEVYVFATPEKLESRDKRTLACLIENFMPEDISVQWLHSDVQLPDTRHSVTQPRKTKGSGFFVFSRLEVTKAEWEQKDEFICRAVHEAASPSWIVQQAVSVNPGK
- Uniprot:
- G8F4W7
- Extra Details:
- IgE protein is an important immunoglobulin component that participates in the recognition and effector phases of humoral immunity. As a membrane-bound receptor on B lymphocytes, IgE triggers clonal expansion upon antigen binding, leading to plasma cell differentiation.
- Shipping Conditions:
- Blue Ice