Recombinant Mouse IgG2B Protein

Size

£145.00

SKU:: RPT0025
Additional Names:: Ighg2b,Igh-3,Ig gamma-2B chain C region ,Immunoglobulin heavy constant gamma 2B
Molecular Weight:: 35-45 kDa
Purity:: ≥90%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Glu97-Lys335
Formulation:: Recombinant Mouse IgG2B Protein Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu97-Lys335) of Mouse IgG2b (Accession #P01867-2) fused with a His tag at the N-terminus.
Species:: Mouse
Sequence:: PSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK
Uniprot:: P01867-2
Synonyms:: gamma2b;IgG2;IgG2b;Igh-3;immunoglobulin heavy chain 3 (serum IgG2b)
Extra Details:: IgG2b,Type I receptor for TGF-beta family ligands BMP9/GDF2 and BMP10 and important regulator of normal blood vessel development. On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. May bind activin as well.