RPT0024
Recombinant Mouse IgG2C Protein

Size
£276.00
- SKU:
- RPT0024
- Additional Names:
- Immunoglobulin heavy constant gamma 2C ,Ighg2c
- Molecular Weight:
- 30-35 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Glu98-Lys335
- Formulation:
- Recombinant Recombinant Mouse IgG2C Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu98-Lys335) of Mouse IgG2C fused with His tag at the N-terminus.
- Species:
- Mouse
- Sequence:
- ESRRPIPPNSCPPCKECSIFPAPDLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNRALPSPIEKTISKPRGPVRAPQVYVLPPPAEEMTKKEFSLTCMITDFLPAEIAVDWTSNGHKELNYKNTAPVLDTDGSYFMYSKLRVQKSTWEKGSLFACSVVHEGLHNHHTTKTISRSLGK
- Extra Details:
- Mouse IgG2c is a subclass of mouse antibody IgG, it can bind FcG GammaRIV with high affinity and the Fc loop residues of mouse IgG2c promote greater receptor-binding affinity than mouse IgG2b or human IgG1.
- Shipping Conditions:
- Blue Ice

