RPT0023
Recombinant Human IgA1 Protein

Size
£205.00
- SKU:
- RPT0023
- Additional Names:
- Immunoglobulin heavy constant alpha 1,Ig alpha-1 chain C region,Ig alpha-1 chain C region BUR,Ig alpha-1 chain C region TRO ,IGHA1 ,IgA1
- Molecular Weight:
- 30-40 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Cys122-Tyr353
- Formulation:
- Recombinant Recombinant Human IgA1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys122-Tyr353) of Human IgA1 (Accession #P01876-1) fused with His tag at the N-terminus.
- Species:
- Human
- Sequence:
- CCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLADWQMPPPYVVLDLPQETLEE
- Uniprot:
- P01876-1
- Synonyms:
- Ig alpha-1 chain C region;Ig alpha-1 chain C region BUR;Ig alpha-1 chain C region TRO;IgA1;immunoglobulin alpha 1;immunoglobulin heavy chain constant region alpha 1
- Extra Details:
- Recombinant Human IgA1 Protein , Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens . The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen .
- Shipping Conditions:
- Blue Ice




